PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G06680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 544aa    MW: 60701.2 Da    PI: 6.3432
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G06680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS418.55.7e-1281675352374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++++ +c +av++++    + l+++l++++s +g+pmqRl ay++e+L arl+++++ lyk+l+++e +   s e +++++l++e++P++kf++
  ORUFI03G06680.1 167 KQVIAACGKAVDENS-WYRDLLISELRNMVSISGEPMQRLGAYMLEGLVARLSSTGHALYKSLKCKEPT---SFELMSYMHLLYEICPFFKFGY 256
                      677888999998854.4568899*********************************************9...99999***************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      + aN aI eav+ge+ vHiiDf+i qG QW++++qaLa+Rp+gpp lRiTg+++++s   +   l  +g+rL ++A+++g+pfefn+ v  + +
  ORUFI03G06680.1 257 MSANGAIAEAVKGENFVHIIDFQIAQGSQWATMIQALAARPGGPPYLRITGIDDSNSAhaRGGGLDIVGRRLFNIAQSCGLPFEFNA-VPAASH 349
                      ******************************************************8888889999***********************.799999 PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                      ++ le+L++++gE+++Vn+++qlh+++desv +e++rd++L++vk+lsP+vv++veqea++n+++F++r le+l+yy+a+f+++++  pr++++
  ORUFI03G06680.1 350 EVMLEHLDIRSGEVIVVNFAYQLHHTPDESVGIENHRDRILRMVKGLSPRVVTLVEQEANTNTAPFFNRYLETLDYYTAMFEAIDVACPRDDKK 443
                      999******************************************************************************************* PP

             GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      ri+ E+++++r+ivn++acegaer+erhe ++kWr+rl++aGF+p+pls  +++++k ll  ++s  y++ee++g+l+lgWk+r+Lv+ SaWr
  ORUFI03G06680.1 444 RISTEQHCVARDIVNLIACEGAERVERHEPFGKWRARLSMAGFRPYPLSALVNNTIKKLLDSYHSY-YKLEERDGALYLGWKNRKLVVSSAWR 535
                      ****************************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.845140516IPR005202Transcription factor GRAS
PfamPF035142.0E-125167535IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MSMKASNRPY RYPDNSQIPY YSRSSMHVGQ NGTYHVQQNH EDLYASSDDG SQNGNSKAQG  60
LQAQYCTLDS SSGNFVYPAH SSTSSHISGS PISQQDSHSE HTSGSPASAS CVTEVPGLRF  120
TTIEEIENAM FGPEPDTVSS DCSLLTDSAF YQDNWREHLG INTGDLKQVI AACGKAVDEN  180
SWYRDLLISE LRNMVSISGE PMQRLGAYML EGLVARLSST GHALYKSLKC KEPTSFELMS  240
YMHLLYEICP FFKFGYMSAN GAIAEAVKGE NFVHIIDFQI AQGSQWATMI QALAARPGGP  300
PYLRITGIDD SNSAHARGGG LDIVGRRLFN IAQSCGLPFE FNAVPAASHE VMLEHLDIRS  360
GEVIVVNFAY QLHHTPDESV GIENHRDRIL RMVKGLSPRV VTLVEQEANT NTAPFFNRYL  420
ETLDYYTAMF EAIDVACPRD DKKRISTEQH CVARDIVNLI ACEGAERVER HEPFGKWRAR  480
LSMAGFRPYP LSALVNNTIK KLLDSYHSYY KLEERDGALY LGWKNRKLVV SSAWRFFRGF  540
LVDA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-581635351375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1166040.0AC116604.1 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0019D17, from chromosome 3, complete sequence.
GenBankAC1507510.0AC150751.1 Oryza sativa Japonica Group chromosome 3 clone OSJNOa0279P04, complete sequence.
GenBankAK0733860.0AK073386.1 Oryza sativa Japonica Group cDNA clone:J033041E22, full insert sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630858.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630859.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630860.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630861.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630862.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630863.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLA0A0E0NQW50.0A0A0E0NQW5_ORYRU; Uncharacterized protein
STRINGLOC_Os03g09280.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA012030-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein